Sergey Ovchinnikov

I'm excited to share that I'll be joining @MITBiology as an Asst Prof. in Jan 2024! Come join us! 🤓🧪🖥️🧬

Colab Pro is now available for free for verified US students and faculty for one year.

Hey smart people out there, what structure does this protein fold into? Hint: AlphaFold, ESMFold, Boltz, Chai, etc are wrong 🤭. Good luck! >whatami MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG

Presenting La-Proteina! A new model for scalable, all-atom protein design 🧬 Backbone + sequence + side-chains, indexed and unindexed atomistic motif scaffolding, scalable up to 800 residues, and more… A thread 🧵

is this how small molecules bind? 😼

since (AI-generated) protein folding (videos) is solved, we now tackle protein conformational changes

Ok @sokrypton here's what I was thinking for doing protein folding with @midjourney video. beta-lactamase folding

Has anyone had any luck getting #veo3 to generate protein folding videos? here are my attempts:

quick reminder to join us tonight at @harvardmed for a great talk by Colby Ford @c01_by

Announcing Ambient Protein Diffusion, a state-of-the-art 17M-params generative model for protein structures. Diversity improves by 91% and designability by 26% over previous 200M SOTA model for long proteins. The trick? Treat low pLDDT AlphaFold predictions as low-quality data